Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr7g076080.1
Common NameMTR_7g076080
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family HD-ZIP
Protein Properties Length: 779aa    MW: 85731.5 Da    PI: 6.6691
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr7g076080.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
         Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      +++ +++t++q++eLe++F+++++p++++r eL+k+l L++rqVk+WFqNrR+++k
                      688999***********************************************999 PP

            START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv........dsgealrasgvvdmvlallveellddkeqWdetla....k 78 
                      ela++a++elvk+a+ +ep+W +s+    e+ n +e+++++++           + +ea+r+sgvv+ ++  lve+l+d++ +W+e+++    +
                      5899*********************999988899999999955..3458999999**************************.************ PP

            START  79 aetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.sssvvRaellpSgiliepksnghskv 164
                       +t+evissg      galqlm+aelq+lsplvp R++ f+R+++q+ +g+w++vdvS+d  ++ +   + +  +++lpSg+++++++ng+skv
                      ****************************************************************9999************************** PP

            START 165 twvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                      twveh++++++++h+l+r+l++ g+ +ga++wvatlqrqce+
                      ****************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.29789149IPR001356Homeobox domain
SMARTSM003899.5E-1890153IPR001356Homeobox domain
CDDcd000861.74E-1891149No hitNo description
PfamPF000462.0E-1892147IPR001356Homeobox domain
PROSITE patternPS000270124147IPR017970Homeobox, conserved site
PROSITE profilePS5084845.284282520IPR002913START domain
SuperFamilySSF559615.33E-35283517No hitNo description
CDDcd088758.15E-120286516No hitNo description
PfamPF018525.0E-56291517IPR002913START domain
SMARTSM002345.0E-50291517IPR002913START domain
SuperFamilySSF559613.35E-23539762No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 779 aa     Download sequence    Send to blast
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1487640.0AC148764.16 Medicago truncatula clone mth2-30o12, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003623826.10.0homeobox leucine zipper protein
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLG7L2F00.0G7L2F0_MEDTR; Homeobox leucine zipper protein
STRINGGLYMA18G45970.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4